HPA006371

ADNP antibody from Sigma-Aldrich
ADNP1, KIAA0784
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006371
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006371, RRID:AB_1078105
Product name
Anti-ADNP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006371
Antibody type
Polyclonal
Antigen
Activity-dependent neuroprotector recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASES
EEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVD
QDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKP
GTWSDESSQSEDARSSKPAAKKKATMQGDREQLKW
KNSSYGKVEG
Storage
-20C
Provider Type Product Number
- No reagents -