H00081030-M01
antibody from Abnova Corporation
Targeting: ZBP1
C20orf183, DAI, dJ718J7.3, DLM-1, DLM1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00081030-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00081030-M01, RRID:AB_1717222
- Product name
- ZBP1 monoclonal antibody (M01), clone 2C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZBP1.
- Antigen sequence
AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVK
ECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGT
DPEGEGPAELALSSPAKRPQQHAATIPET- Isotype
- IgG
- Antibody clone number
- 2C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ZBP1 expression in transfected 293T cell line by ZBP1 monoclonal antibody (M01), clone 2C10.Lane 1: ZBP1 transfected lysate (Predicted MW: 16 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ZBP1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ZBP1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ZBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol