HPA021294

PRXL2C antibody from Atlas Antibodies
AAED1, C9orf21

Antibody data

Product number
HPA021294
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021294, RRID:AB_1845818
Product name
Anti-AAED1
Provider product page
Atlas Antibodies - HPA021294
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIY
VDPEREIYKRLGMKRGEEIASSGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.