PAB21381

PRXL2C antibody from Abnova Corporation
AAED1, C9orf21

Antibody data

Product number
PAB21381
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21381, RRID:AB_10963551
Product name
AAED1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21381
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant AAED1.
Antigen sequence
SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIY
VDPEREIYKRLGMKRGEEIASSGQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.