HPA006303

MYT1 antibody from MilliporeSigma / Merck KGaA
MTF1, MYTI, NZF2, PLPB1, ZC2H2C1, ZC2HC4A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006303
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006303, RRID:AB_1079446
Product name
Anti-MYT1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006303
Antibody type
Polyclonal
Antigen
Myelin transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEY
SVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTR
GNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGL
GEPGKAAKPLDT
Storage
-20C
Provider Type Product Number
- No reagents -