HPA004883

MYEF2 antibody from Sigma-Aldrich
FLJ11213, HsT18564, KIAA1341, MEF-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004883
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004883, RRID:AB_1079436
Product name
Anti-MYEF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004883
Antibody type
Polyclonal
Antigen
Myelin expression factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILE
RSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLP
FDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGT
VRFDSPESAEKACRIMNGIKISGREIDVRLDRN
Storage
-20C
Provider Type Product Number
- No reagents -