HPA018091

C14orf177 antibody from Sigma-Aldrich
FLJ25773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018091
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018091, RRID:AB_1848845
Product name
Anti-C14orf177 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018091
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein C14orf177 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HRKEPGARLEATRGAARPHKQGTKPMITRPSVSQL
GEGKCPSSQHLQSLRHNKQHALTLTKARCCGECST
CFCTEEKSECQRHEETSPGSCNHQIMSASTISAFC
ATPRFKQLFKGTVEQMSQM
Storage
-20C
Provider Type Product Number
- No reagents -