AV00019
antibody from MilliporeSigma / Merck KGaA
Targeting: NLRC4
CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, ipaf
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV00019 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-CARD12 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human CARD12 with an internal ID of P01126
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
LKNFQQLNLAGNRVSSDGWLAFMGVFENLKQLVFF
DFSTKEFLPDPALVR- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data