HPA019051

CCDC6 antibody from Atlas Antibodies
D10S170, H4, PTC, TPC, TST1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019051
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019051, RRID:AB_1846164
Product name
Anti-CCDC6
Provider product page
Atlas Antibodies - HPA019051
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQ
LQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTI
SKQLTLEQLRREKI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -