HPA004776

AKAP8 antibody from Sigma-Aldrich
AKAP95, DKFZp586B1222
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004776
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004776, RRID:AB_1078122
Product name
Anti-AKAP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004776
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVR
AVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAE
QLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMA
AEAESAQTRVAPAPAAADAEVEQTDAESKDAVP
Storage
-20C
Provider Type Product Number
- No reagents -