Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005252-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005252-M01, RRID:AB_916019
- Product name
- PHF1 monoclonal antibody (M01), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PHF1.
- Antigen sequence
AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQD
VLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQF
LVLWKDISPAALPGEELLCCVCRSETVVP- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Val97Leu mutant presenilin-1 induces tau hyperphosphorylation and spatial memory deficit in mice and the underlying mechanisms.
A polycomb group protein, PHF1, is involved in the response to DNA double-strand breaks in human cell.
Impairments in fast axonal transport and motor neuron deficits in transgenic mice expressing familial Alzheimer's disease-linked mutant presenilin 1.
Wang Y, Cheng Z, Qin W, Jia J
Journal of neurochemistry 2012 Apr;121(1):135-45
Journal of neurochemistry 2012 Apr;121(1):135-45
A polycomb group protein, PHF1, is involved in the response to DNA double-strand breaks in human cell.
Hong Z, Jiang J, Lan L, Nakajima S, Kanno S, Koseki H, Yasui A
Nucleic acids research 2008 May;36(9):2939-47
Nucleic acids research 2008 May;36(9):2939-47
Impairments in fast axonal transport and motor neuron deficits in transgenic mice expressing familial Alzheimer's disease-linked mutant presenilin 1.
Lazarov O, Morfini GA, Pigino G, Gadadhar A, Chen X, Robinson J, Ho H, Brady ST, Sisodia SS
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Jun 27;27(26):7011-20
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Jun 27;27(26):7011-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PHF1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of PHF1 expression in A-431 ( Cat # L015V1 ).