Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184335 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-POU Domain, Class 3, Transcription Factor 4 (POU3F4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POU3F4 antibody: synthetic peptide directed towards the C terminal of human POU3F4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHE
VYSHT VKTDTSCHDL- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Late-onset hearing loss in a mouse model of DFN3 non-syndromic deafness: morphologic and immunohistochemical analyses.
Dynamic aspects of guinea pig inner hair cell receptor potentials with transient asphyxia.
Xia AP, Kikuchi T, Minowa O, Katori Y, Oshima T, Noda T, Ikeda K
Hearing research 2002 Apr;166(1-2):150-8
Hearing research 2002 Apr;166(1-2):150-8
Dynamic aspects of guinea pig inner hair cell receptor potentials with transient asphyxia.
Nuttall AL
Hearing research 1984 Oct;16(1):1-16
Hearing research 1984 Oct;16(1):1-16
No comments: Submit comment
No validations: Submit validation data