HPA020536

NSUN5 antibody from Atlas Antibodies
FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020536
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020536, RRID:AB_1858789
Product name
Anti-NSUN5
Provider product page
Atlas Antibodies - HPA020536
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASS
LDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPL
YRAGHLIL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -