HPA045590

NSUN5 antibody from Atlas Antibodies
FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL

Antibody data

Product number
HPA045590
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045590, RRID:AB_2679376
Product name
Anti-NSUN5
Provider product page
Atlas Antibodies - HPA045590
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALT
FPSLQRL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -