PAB21311

NSUN5 antibody from Abnova Corporation
FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL

Antibody data

Product number
PAB21311
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21311, RRID:AB_10965982
Product name
NSUN5 polyclonal antibody
Provider product page
Abnova Corporation - PAB21311
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant NSUN5.
Antigen sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASS
LDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPL
YRAGHLIL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -