HPA020536

NSUN5 antibody from Sigma-Aldrich
FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020536, RRID:AB_1858789
Product name
Anti-NSUN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020536
Antibody type
Polyclonal
Antigen
Putative methyltransferase NSUN5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASS
LDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPL
YRAGHLIL
Storage
-20C
Provider Type Product Number
- No reagents -