HPA023648

PROCA1 antibody from Sigma-Aldrich
MGC39650
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023648
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023648, RRID:AB_1855726
Product name
Anti-AC005726.8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023648
Antibody type
Polyclonal
Antigen
Protein PROCA1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTLTIERWTKEKTEPKARSWDESRCRGDCKEPDKC
CWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCN
S
Storage
-20C
Provider Type Product Number
- No reagents -