HPA005670

DLX5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005670
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005670, RRID:AB_1078681
Product name
Anti-DLX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005670
Antibody type
Polyclonal
Antigen
Homeobox protein DLX-5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESS
ATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQ
YHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRV
PSATNQPEKEVTEPEVRMVNGKPKKVRKP
Storage
-20C
Provider Type Product Number
- No reagents -