PAB21252

TRIM50 antibody from Abnova Corporation
FLJ32804, TRIM50A

Antibody data

Product number
PAB21252
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21252, RRID:AB_10963563
Product name
TRIM50 polyclonal antibody
Provider product page
Abnova Corporation - PAB21252
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TRIM50.
Antigen sequence
AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPL
KLDPATAHPLLELSKGNTVVQCGLLAQRRASQPER
FDYSTC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -