HPA019862

TRIM50 antibody from Sigma-Aldrich
FLJ32804, TRIM50A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019862, RRID:AB_1858305
Product name
Anti-TRIM50 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019862
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 50 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPL
KLDPATAHPLLELSKGNTVVQCGLLAQRRASQPER
FDYSTC
Storage
-20C
Provider Type Product Number
- No reagents -