Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004933 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-HOXA1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSC
AVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHP
QPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSP
YALNQEADPP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Pbx Interaction Motif of Hoxa1 Is Essential for Its Oncogenic Activity
Pentapeptide insertion mutagenesis of the Hoxa1 protein: Mapping of transcription activation and DNA‐binding regulatory domains
Wutz A, Delval S, Taminiau A, Lamy J, Lallemand C, Gilles C, Noël A, Rezsohazy R
PLoS ONE 2011;6(9):e25247
PLoS ONE 2011;6(9):e25247
Pentapeptide insertion mutagenesis of the Hoxa1 protein: Mapping of transcription activation and DNA‐binding regulatory domains
Lambert B, Vandeputte J, Desmet P, Hallet B, Remacle S, Rezsohazy R
Journal of Cellular Biochemistry 2010;110(2):484-496
Journal of Cellular Biochemistry 2010;110(2):484-496
No comments: Submit comment
No validations: Submit validation data