HPA004933

HOXA1 antibody from Sigma-Aldrich
HOX1, HOX1F
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004933, RRID:AB_1079078
Product name
Anti-HOXA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004933
Antibody type
Polyclonal
Antigen
Homeobox protein Hox-A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSC
AVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHP
QPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSP
YALNQEADPP
Storage
-20C
Provider Type Product Number
- No reagents -