H00006300-M04A

MAPK12 antibody from Abnova Corporation
ERK6, p38gamma, PRKM12, SAPK-3, SAPK3

Antibody data

Product number
H00006300-M04A
Provider
Abnova Corporation
Product name
MAPK12 monoclonal antibody (M04A), clone 2C1
Provider product page
Abnova Corporation - H00006300-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPK12.
Antigen sequence
QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
NLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDE
PQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPR
QLGARVSKETPL
Isotype
IgG
Antibody clone number
2C1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -