HPA054562

MAPK12 antibody from Atlas Antibodies
ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA054562
Provider
Atlas Antibodies
Product name
Anti-MAPK12
Provider product page
Atlas Antibodies - HPA054562
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKN
YMKGLPELEKKDFASILTNASPLAV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -