HPA054562

MAPK12 antibody from Atlas Antibodies
ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA054562
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054562, RRID:AB_2682524
Product name
Anti-MAPK12
Provider product page
Atlas Antibodies - HPA054562
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKN
YMKGLPELEKKDFASILTNASPLAV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -