HPA018841

MAPK12 antibody from Sigma-Aldrich
ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018841
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018841, RRID:AB_1856574
Product name
Anti-MAPK12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018841
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSD
EAKNYMKGLPELEKKDFASILTNASPLAVNLLEKM
LVLDAEQRVTAGEALAHPYFESLH
Storage
-20C
Provider Type Product Number
- No reagents -