H00053349-B01P

ZFYVE1 antibody from Abnova Corporation
DFCP1, KIAA1589, PPP1R172, TAFF1, ZNFN2A1

Antibody data

Product number
H00053349-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00053349-B01P, RRID:AB_1582027
Product name
ZFYVE1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00053349-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZFYVE1 protein.
Antigen sequence
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECD
ECCSLQCLRCEEELHRQERLRNHERIRLKPGHVPY
CDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQK
RTHSGGNKRRHPVTVYNVSNLQESLEAEEMDEETK
RKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCK
PDQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKT
SPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVN
LSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFL
GDASEAYLKHFTKELKATTARCGLDVPLSTLGPAV
IIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRF
PEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENN
TTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEA
KSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSA
STDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWF
GNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRL
LDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYW
RPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDS
CSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVT
EAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPL
GLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKH
HCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNC
NKKPGDL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -