HPA002898

ZFYVE1 antibody from Sigma-Aldrich
DFCP1, KIAA1589, PPP1R172, TAFF1, ZNFN2A1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002898
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002898, RRID:AB_1080653
Product name
Anti-ZFYVE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002898
Antibody type
Polyclonal
Antigen
Zinc finger FYVE domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACG
EGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARN
VQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVT
AIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFS
IKLSKHH
Storage
-20C
Provider Type Product Number
- No reagents -