Antibody data

Product number
ABIN501839
Provider
antibodies-online
Product name
anti-Homeobox A6 (HOXA6) antibody
Provider product page
antibodies-online - ABIN501839
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXA6 antibody: synthetic peptide directed towards the middle region of human HOXA6
Reactivity
Human, Mouse, Rat, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
YLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE
NKLIN STQPSGEDSE
Vial size
50 µg
Provider Type Product Number
- No reagents -