HPA004203

HOXA6 antibody from Sigma-Aldrich
HOX1, HOX1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004203
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004203, RRID:AB_1079079
Product name
Anti-HOXA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004203
Antibody type
Polyclonal
Antigen
Homeobox protein Hox-A6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQS
NSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQ
RGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRK
YTSPV
Storage
-20C
Provider Type Product Number
- No reagents -