Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405585 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP46A1 antibody: synthetic peptide directed towards the C terminal of human CYP46A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPF
SLGHR SCIGQQFAQM- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association of blood pressure and genetic background with white matter lesions in patients with mild cognitive impairment.
Galluzzi S, Geroldi C, Benussi L, Ghidoni R, Testa C, Borsci G, Bonetti M, Manfellotto D, Romanelli G, Zulli R, Binetti G, Frisoni GB
The journals of gerontology. Series A, Biological sciences and medical sciences 2008 May;63(5):510-7
The journals of gerontology. Series A, Biological sciences and medical sciences 2008 May;63(5):510-7
No comments: Submit comment
No validations: Submit validation data