HPA024037

ZFP91 antibody from Atlas Antibodies
PZF, ZNF757
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024037
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024037, RRID:AB_1859051
Product name
Anti-ZFP91
Provider product page
Atlas Antibodies - HPA024037
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEHQSPGGISSEEEEEEEEEMLISEEEIPFKDDPR
DETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEV
EVEVKEEENEIREDEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -