Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024529 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024529, RRID:AB_1857869
- Product name
- Anti-TDRD7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHR
SINRQITNADLWKHQKDVFLSAISSGADSPNSKNG
NMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEE
LPPPV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel application for pseudopodia proteomics using excimer laser ablation and two-dimensional difference gel electrophoresis
Ito A, Mimae T, Yamamoto Y, Hagiyama M, Nakanishi J, Ito M, Hosokawa Y, Okada M, Murakami Y, Kondo T
Laboratory Investigation 2012 July;92(9):1374-1385
Laboratory Investigation 2012 July;92(9):1374-1385
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.
- Sample type
- HUMAN