HPA024529

TDRD7 antibody from Sigma-Aldrich
PCTAIRE2BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024529
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024529, RRID:AB_1857869
Product name
Anti-TDRD7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024529
Antibody type
Polyclonal
Antigen
Tudor domain-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHR
SINRQITNADLWKHQKDVFLSAISSGADSPNSKNG
NMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEE
LPPPV
Storage
-20C
Provider Type Product Number
- No reagents -