HPA018503

CSRNP2 antibody from Sigma-Aldrich
C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018503
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018503, RRID:AB_1845535
Product name
Anti-CSRNP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018503
Antibody type
Polyclonal
Antigen
TGF-beta-induced apoptosis protein 12 (TAIP-12) (Protein FAM130A1)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEP
SPTASCSLTGAQGSETQDFQEFIAENETAVMHLQS
AEELERLKAEEDSSGSSAS
Storage
-20C
Provider Type Product Number
- No reagents -