HPA004899

BCL6 antibody from Sigma-Aldrich
BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004899, RRID:AB_1078273
Product name
Anti-BCL6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004899
Antibody type
Polyclonal
Antigen
B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNA
PYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRK
GLVSPQSPQKSDCQPNSPTESCSSKNACILQASGS
PPAKSPTDPKACNWKKYKFIVLNS
Storage
-20C
Provider Type Product Number
- No reagents -