HPA004793

ARID3A antibody from Atlas Antibodies
BRIGHT, DRIL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004793
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004793, RRID:AB_1847870
Product name
Anti-ARID3A
Provider product page
Atlas Antibodies - HPA004793
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
SSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVV
AAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEP
PEKKMALVADEQQRLMQRALQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -