HPA004793

ARID3A antibody from Sigma-Aldrich
BRIGHT, DRIL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004793
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004793, RRID:AB_1847870
Product name
Anti-ARID3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004793
Antibody type
Polyclonal
Antigen
AT-rich interactive domain-containing protein 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
SSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVV
AAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEP
PEKKMALVADEQQRLMQRALQQ
Storage
-20C
Provider Type Product Number
- No reagents -