Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005463-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005463-M01, RRID:AB_606812
- Product name
- POU6F1 monoclonal antibody (M01), clone 6H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POU6F1.
- Antigen sequence
ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFV
GGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQ
EITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNV
FQIP- Isotype
- IgG
- Antibody clone number
- 6H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- POU6F1 monoclonal antibody (M01), clone 6H1 Western Blot analysis of POU6F1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of POU6F1 expression in transfected 293T cell line by POU6F1 monoclonal antibody (M01), clone 6H1.Lane 1: POU6F1 transfected lysate(32.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged POU6F1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol