HPA024241

TSTD2 antibody from Sigma-Aldrich
C9orf97, PP4189
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024241
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024241, RRID:AB_1845851
Product name
Anti-C9orf97 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024241
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf97 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPGIHLSPGEFHKEVEKFLSQANQEQSDTILLDCR
NFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELF
REKRVLMYCTGGIRCERGSAYLKAKGVC
Storage
-20C
Provider Type Product Number
- No reagents -