HPA004806

ASH1L antibody from Sigma-Aldrich
ASH1, ASH1L1, huASH1, KMT2H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004806, RRID:AB_1845087
Product name
Anti-ASH1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004806
Antibody type
Polyclonal
Antigen
Probable histone-lysine N-methyltransferase ASH1L recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPSPSFTTPLPPPSYMHAGHLLLNPAKYHKKKHKL
LRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEH
KHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKR
YRFGKDAVGERYKHKEKHRCHMSCPHLSPSKSLIN
REEQWVHR
Storage
-20C
Provider Type Product Number
- No reagents -