HPA007114

MEF2D antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007114, RRID:AB_1079353
Product name
Anti-MEF2D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007114
Antibody type
Polyclonal
Antigen
Myocyte-specific enhancer factor 2D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVP
VSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVS
PSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYE
TGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMR
LDTWTL
Storage
-20C
Provider Type Product Number
- No reagents -