HPA019728

ITFG1 antibody from Atlas Antibodies
CDA08, LNKN-1, TIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019728
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019728, RRID:AB_1846348
Product name
Anti-ITFG1
Provider product page
Atlas Antibodies - HPA019728
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNY
AKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLI
MDFNGDLIPDIFGITNESNQPQILLGGNLSWHPAL
TTTSKMRIPHSHAFIDLTEDFTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -