H00081533-B01

ITFG1 antibody from Abnova Corporation
CDA08, LNKN-1, TIP

Antibody data

Product number
H00081533-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081533-B01, RRID:AB_1113334
Product name
CDA08 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00081533-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CDA08 protein.
Antigen sequence
MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALH
NVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVP
GDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGIT
NESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFS
VSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWG
FVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYW
ELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPR
KITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGE
KSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKA
DDREKRQEAHRFHFDAM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.