H00081533-B01P

ITFG1 antibody from Abnova Corporation
CDA08, LNKN-1, TIP

Antibody data

Product number
H00081533-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081533-B01P, RRID:AB_1575663
Product name
ITFG1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00081533-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ITFG1 protein.
Antigen sequence
MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALH
NVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVP
GDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGIT
NESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFS
VSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWG
FVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYW
ELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPR
KITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGE
KSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKA
DDREKRQEAHRFHFDAM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.