HPA015590

ITFG1 antibody from MilliporeSigma / Merck KGaA
CDA08, LNKN-1, TIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015590
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ITFG1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015590
Antibody type
Polyclonal
Antigen
T-cell immunomodulatory protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVP
FVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKN
TSGSNQQAFLLENVPCNNASCEEARRMFKVYWELT
DLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKND
Storage
-20C