HPA019728

ITFG1 antibody from Sigma-Aldrich
CDA08, LNKN-1, TIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019728
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019728, RRID:AB_1846348
Product name
Anti-ITFG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019728
Antibody type
Polyclonal
Antigen
T-cell immunomodulatory protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNY
AKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLI
MDFNGDLIPDIFGITNESNQPQILLGGNLSWHPAL
TTTSKMRIPHSHAFIDLTEDFTA
Storage
-20C
Provider Type Product Number
- No reagents -