HPA028321

AGMAT antibody from Sigma-Aldrich
FLJ23384
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028321
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028321, RRID:AB_10600779
Product name
Anti-AGMAT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028321
Antibody type
Polyclonal
Antigen
agmatine ureohydrolase (agmatinase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISF
DI
Storage
-20C
Provider Type Product Number
- No reagents -