Antibody data

Product number
H00002117-M02
Provider
Abnova Corporation
Product name
ETV3 monoclonal antibody (M02), clone 1C11
Provider product page
Abnova Corporation - H00002117-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ETV3.
Antigen sequence
MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQI
QLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPD
EVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHK
TKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLL
VGN
Isotype
IgG
Antibody clone number
1C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -