Antibody data

Product number
PAB20280
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20280, RRID:AB_10963343
Product name
ETV3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20280
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ETV3.
Antigen sequence
EKEEHTQEEGTVPSRTIEEEKGTIFARPAAPPIWP
SVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDA
LMPPKLRLKRRWNDDPEARELSKSGKFLWNG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -