HPA004794

ETV3 antibody from Sigma-Aldrich
PE-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004794
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004794, RRID:AB_1078761
Product name
Anti-ETV3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004794
Antibody type
Polyclonal
Antigen
ETS translocation variant 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKEEHTQEEGTVPSRTIEEEKGTIFARPAAPPIWP
SVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDA
LMPPKLRLKRRWNDDPEARELSKSGKFLWNG
Storage
-20C
Provider Type Product Number
- No reagents -